by | Dec 20, 2021 | Web programming
As a beginner level, it is better to use simple code and stick close to the instructions.
The previous knowledge included are Object Oriented Programming, Functional Programming, Regular expression, Numpy and visualization.
The returning files are selectSort.c, sortTime.py, plot.py and plot.png. Thank you.
by | Dec 20, 2021 | Web programming
Assignment – Format a Web page using CSS
Outcomes addressed in this activity:
Unit Outcomes:
Create a table for data using HTML.
Apply advanced CSS to Web pages.
Course Outcome:
IT117-3: Integrate CSS with HTML to create a visually appealing website.
Purpose
This week you will continue to work with CSS by adding additional style rules to your external stylesheet, styles.css. You will also develop your Menu page. You will add a table to your page as well as the Menu page content. You will write a class and an ID in your CSS that will be used to format your Menu page table. Demonstrating your ability to develop these more advanced HTML and CSS elements will add depth and interest to your Web pages and give you the opportunity to showcase some of your creativity.
Assignment Instructions
Complete the Menu page for your restaurant website and customize CSS formatting for History and Menu pages.
Open menu.html in Notepad to edit it.
Type the name of the restaurant as well as the word “Menu” inside the title tag.
Add a level 1 (h1) heading to the page that is appropriate for the page.
Add a table to the Menu page.
Code your table between and tags.
Table must be at least three (3) columns and three (3) rows.
Table must include at least one merged cell using either colspan or rowspan attributes and must use the tag pair at least once.
Add content to the table cells. Table must include at least two (2) menu items with descriptions.
Throughout the rest of the page, you may add appropriate subheadings (h2, h3, etc.), a second table, paragraph text, and/or list code as needed to complete the remaining page content. Content should be appropriate for the Menu page and must include at least 50 words.
Format menu page using CSS. Open styles.css to edit in Notepad. Apply the following style rules to styles.css to format the page columns:
Set a width for the table using a percent value
Add a background color to the table
Write an ID to apply to the table tag.
Your ID can format any element of the table, such as font-family or alignment.
Name your ID something logical according to the function. (Remember an ID can only be used once on a page.)
Write a class to change one element within the table.
Name your class something logical according to the function, (i.e., .rowcolor or.boldtext).
Your class can change the background color of a cell or row, change the text color for one table cell or row, align the content of one table cell or row, or emphasize the text in one table cell or row by applying bold or italics.
The class can be called in one or more tag, tag, or tags. For example:
or
Keep in mind the tag pair automatically displays text centered and bold.
Save.
Apply two (2) additional changes to CSS.
Using your knowledge of CSS, make two (2) changes to your CSS stylesheet code.
At least one change must be made to the navigation formatting.
The second change can be to the navigation or another element.
Save and close styles.css.
Upload the menu.html and updated styles.css pages to the Web server.
Directions for Submitting Your Assignment
Post the URL to the menu.html page to the Dropbox.
Written work should be free of spelling, grammar, and APA errors. Points deducted from the grade for each writing, spelling, or grammar error are at your instructor’s discretion.
Review the grading rubric before beginning this Activity.
I will tip also if you can help me fix me index.html file I must’ve coded it wrong
by | Dec 18, 2021 | Web programming
Not difficult first year assighnment shouldn’t take long . The assignment says 4 questions but it is actually 3. The second “question” is to just attach an image of what the code creates. I attached the instructions under the PDF project 3. The questions are attached under the PDF project 3 report. My “net ID” is yes19 so it is required to use the letter Y.
by | Dec 18, 2021 | Web programming
Complete the BinarySearchTree.h file especially the insert and remove method. Please help me satisfy the criteria.
The p2.txt contains the Map.h, Set.h and Main.cpp that doesn’t need to be edited. It also contains the BinarySearchTree.h that needs to be completed.
by | Dec 18, 2021 | Web programming
q1:
Load the trajectory file in VMD ( the files you need are in a compressed folder on blackboard).
Calculate the RMSD, contact map along the trajectory time. Explain what the RMSD, contact map are, and what information they provide. (10 points)
Calculate the distance between residue 56 atom O and residue 290 atom CA. (5 points)
Calculate the Phi and Psi angles of residue 299 along the trajectory time. (10 points)
q2: Go to the PDB databank and download the structure of 2HHB.
Show in details the steps you need to take to prepare your protein for Molecular Dynamics Simulations. Provide snapshots, save all in a word document
q3: Use MODELLER to generate an initial structural model for the following target sequence:
PIVDSGSVAPLSAAEKTKIRSAWAPVYSNYETSGVDILVKFFTSTPAAQEFFPKFKGMTSADQLKKSADVRWHAERIINA
VNDAVASMDDTEKMSMKLRDLSGKHAKSFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSAY
In your search, use homologous sequences with known structures for protein in humans (taxid: 9606).
Follow the steps you have learned to generate the best models.
Use the files in the ModelScripts folder to run modeller, and document carefully your input and output results in a separate word document.
To test your model compare it with the chain A of PDB code 1UC3.
Answer questions in complete sentences wherever possible, and insert screenshots when necessary in a word document
by | Dec 18, 2021 | Web programming
donot use jquery or bootsstrap please. please donot copy paste codes from browser. Please read the step by step guide for assignment i will upload and the assignment specification carefully.
Comments from Customer
Hi there, please read the instructions on the specification and assignment worksheet properly. Its got all the information that is needed. Please donot copy paste codes or use j query or bootstrap kindly. No plagarism please. The assignment worksheet that i have uploaded has all step by step guide of how to proceed with the assignment. Please follow that, and to help it gives examples as well.
Also i uploaded two screenshots of drafts that i am meant to use according to my tutor for html and java scrip page. Please continue from them. For html, start from my draft and the same from java script. I hope i have made myself clear.
One main thing is that, please use prompt boxes in java script like mentioned on assignment worksheet. Thankyou:)